Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008234278.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family HD-ZIP
Protein Properties Length: 808aa    MW: 88013 Da    PI: 6.4208
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008234278.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++k +++t++q++eLe++F+++++p++++r eL+++l+L+++qVk+WFqNrR+++k
                     79999************************************************999 PP

           START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv...dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevi 85 
                     la +a++elvk+a+a++p+W k s    e++n +e++     +     + +e  r++ +v+ ++  lve+l+d + +W e++     +a++++vi
                     57799*******************99999999999987655544466679*************************.******************* PP

           START  86 ssg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlk 173
                     ssg      galq+m aelq+lsplvp R   f+R+++q+++g+w++vdvS+d +q+ +++  +  ++++pSg+++++++n+ skvtw+eh +++
                     *********************************************************************************************** PP

           START 174 grlphwllrslvksglaegaktwvatlqrqcek 206
                     ++++h l+ +l++sg+ +ga++w++tlqrqce+
                     *******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.702114174IPR001356Homeobox domain
SMARTSM003892.8E-18116178IPR001356Homeobox domain
PfamPF000463.1E-18117172IPR001356Homeobox domain
CDDcd000861.67E-19117174No hitNo description
PROSITE patternPS000270149172IPR017970Homeobox, conserved site
PROSITE profilePS5084842.956317551IPR002913START domain
SuperFamilySSF559617.83E-32318548No hitNo description
CDDcd088753.75E-113321547No hitNo description
SMARTSM002342.5E-37326548IPR002913START domain
PfamPF018527.3E-47327548IPR002913START domain
SuperFamilySSF559611.07E-16575802No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 808 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008234278.10.0PREDICTED: homeobox-leucine zipper protein HDG7
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLM5X4A00.0M5X4A0_PRUPE; Uncharacterized protein
STRINGGLYMA10G38280.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein